1.67 Rating by CuteStat

mcc-slpro.org is 9 years 2 months old. It is a domain having org extension. It has a global traffic rank of #9412276 in the world. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, mcc-slpro.org is SAFE to browse.

PageSpeed Score
89
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: 51
Daily Pageviews: 102

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 9,412,276
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

184.175.95.2

Hosted Country:

United States of America US

Location Latitude:

38.6312

Location Longitude:

-90.1922

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 1
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 184.175.95.2)

Family Law Attorney Services : Johnson Law

- familylawlawyerfayettevillenc.com

Johnson law practices family law in Wilmington, NC. We handle cases that consist of child custody to divorces.

Not Applicable $ 8.95

Grandfamilies

- cssgrandfamilies.org
Not Applicable $ 8.95

403 Forbidden

- familylawattorneyfayettevillenc.com
Not Applicable $ 8.95

Error Occurred While Processing Request

- testosteronetherapyschertz.com
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Wed, 24 Feb 2016 20:02:50 GMT
Server: Apache mod_fcgid/2.3.9 mod_jk/1.2.37
Content-Length: 3523
Connection: close
Content-Type: text/html;charset=UTF-8

Domain Information

Domain Registrar: DropCatch.com 1498 LLC
Registration Date: Feb 21, 2015, 12:00 AM 9 years 2 months 1 week ago
Domain Status:
clientTransferProhibited
clientUpdateProhibited
autoRenewPeriod
Owner's E-Mail: mcc@slpro.net

Domain Nameserver Information

Host IP Address Country
ns3.hostek.com 173.245.58.12 United States of America United States of America
ns4.hostek.com 173.245.59.13 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
mcc-slpro.org A 14395 IP: 184.175.95.2
mcc-slpro.org NS 21599 Target: ns4.hostek.com
mcc-slpro.org NS 21599 Target: ns3.hostek.com
mcc-slpro.org SOA 21599 MNAME: ns3.hostek.com
RNAME: cpanel.hostek.com
Serial: 2015061700
Refresh: 86400
Retry: 7200
Expire: 3600000
Minimum TTL: 86400
mcc-slpro.org MX 14399 Target: mcc-slpro.org

Similarly Ranked Websites

Remolque Superior

- remolquesuperior.com
9,412,281 $ 8.95

suiheisenkuma.space - This website is for sale! - suiheisenkuma Resour

- suiheisenkuma.space

This website is for sale! suiheisenkuma.space is your first and best source for all of the information you’re looking for. From general topics to more of what you would expect to find here, suiheisenkuma.space has it all. We hope you find what you are searching for!

9,412,288 $ 8.95


Интернет-магазин велосипедов «Успех» в Екатеринбурге | velouspeh.ru

- velouspeh.ru

Компания ТД «Успех» специализируется на продаже товаров для активного отдыха, среди которых велосипеды, гироскутеры и многое другое. Опт и розница в Екатеринбурге .

9,412,292 $ 240.00

Óêðà¿íñüêà Õðèñòèÿíñüêà ªâàíãåëüñüêà Öåðêâà

- wolua.org

"Ñëîâî æèòòÿ", Óêðà¿íñüêà Õðèñòèÿíñüêà ªâàíãåëüñüêà Öåðêâà

9,412,306 $ 240.00

Full WHOIS Lookup

Domain Name: MCC-SLPRO.ORG
Domain ID: D175394035-LROR
WHOIS Server:
Referral URL: http://www.tucows.com
Updated Date: 2016-02-23T14:42:08Z
Creation Date: 2015-02-21T20:03:35Z
Registry Expiry Date: 2017-02-21T20:03:35Z
Sponsoring Registrar: Tucows Inc.
Sponsoring Registrar IANA ID: 69
Domain Status: clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://www.icann.org/epp#clientUpdateProhibited
Domain Status: autoRenewPeriod https://www.icann.org/epp#autoRenewPeriod
Registrant ID: tuA3xRgC8t3cRlIz
Registrant Name: Len Engel
Registrant Organization: Middlesex Community College
Registrant Street: 33 Kearney Square
Registrant City: Lowell
Registrant State/Province: MA
Registrant Postal Code: 01852
Registrant Country: US
Registrant Phone: +1.2083442500
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: mcc@slpro.net
Admin ID: tuDeYcC6nzxYhPCF
Admin Name: Domains AOS
Admin Organization: Advanced Online Solutions, Inc.
Admin Street: PO Box 701048
Admin City: Tulsa
Admin State/Province: OK
Admin Postal Code: 74170-1048
Admin Country: US
Admin Phone: +1.9183927870
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: domains@hostek.com
Tech ID: tuHcQJ3JDSt66ZQi
Tech Name: Domains AOS
Tech Organization: Advanced Online Solutions, Inc.
Tech Street: PO Box 701048
Tech City: Tulsa
Tech State/Province: OK
Tech Postal Code: 74170-1048
Tech Country: US
Tech Phone: +1.9183927870
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: domains@hostek.com
Name Server: NS4.HOSTEK.COM
Name Server: NS3.HOSTEK.COM
DNSSEC: unsigned
>>> Last update of WHOIS database: 2016-02-24T20:01:54Z